RRP36 Polyclonal AntibodyRRP36 Polyclonal Antibody
Move your mouse over image or click to enlarge

RRP36 Polyclonal Antibody

Cat# Size Price Qty Buy
A14328-200ul 200ul
£332.50
A14328-100ul 100ul
£192.50
A14328-50ul 50ul
£113.75
A14328-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14328
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RRP36; C6orf153; dJ20C7.4; ribosomal RNA processing 36
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-259 of human RRP36 (NP_149103.1).
Reactivity Human
Gene ID 88745
Calculated MW 29kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents