RPL24 Polyclonal AntibodyRPL24 Polyclonal Antibody
Move your mouse over image or click to enlarge

RPL24 Polyclonal Antibody

Cat# Size Price Qty Buy
A14255-200ul 200ul
£332.50
A14255-100ul 100ul
£192.50
A14255-50ul 50ul
£113.75
A14255-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14255
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RPL24; HEL-S-310; L24; ribosomal protein L24
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 38-157 of human RPL24 (NP_000977.1).
Reactivity Human, Mouse
Gene ID 6152
Calculated MW 17kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents