RNF8 Polyclonal AntibodyRNF8 Polyclonal Antibody
Move your mouse over image or click to enlarge

RNF8 Polyclonal Antibody

Cat# Size Price Qty Buy
A14083-200ul 200ul
£332.50
A14083-100ul 100ul
£192.50
A14083-50ul 50ul
£113.75
A14083-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14083
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RNF8; hRNF8; ring finger protein 8
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RNF8 (NP_003949.1).
Reactivity Human
Gene ID 9025
Calculated MW 10kDa/50kDa/55kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents