RND1 Polyclonal AntibodyRND1 Polyclonal Antibody
Move your mouse over image or click to enlarge

RND1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13705-200ul 200ul
£332.50
A13705-100ul 100ul
£192.50
A13705-50ul 50ul
£113.75
A13705-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13705
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RND1; ARHS; RHO6; RHOS; Rho family GTPase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 103-232 of human RND1 (NP_055285.1).
Reactivity Mouse, Rat
Gene ID 27289
Calculated MW 26kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents