RAB8B Polyclonal AntibodyRAB8B Polyclonal Antibody
Move your mouse over image or click to enlarge

RAB8B Polyclonal Antibody

Cat# Size Price Qty Buy
A3678-200ul 200ul
£332.50
A3678-100ul 100ul
£192.50
A3678-50ul 50ul
£113.75
A3678-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3678
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAB8B; ras-related protein Rab-8B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-207 of human RAB8B (NP_057614.1).
Reactivity Human, Mouse, Rat
Gene ID 51762
Calculated MW 23kDa
Observed MW 24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents