PTH2R Polyclonal AntibodyPTH2R Polyclonal Antibody
Move your mouse over image or click to enlarge

PTH2R Polyclonal Antibody

Cat# Size Price Qty Buy
A4058-200ul 200ul
£332.50
A4058-100ul 100ul
£192.50
A4058-50ul 50ul
£113.75
A4058-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4058
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PTH2R; PTHR2; parathyroid hormone 2 receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-145 of human PTH2R (NP_005039.1).
Reactivity Human
Gene ID 5746
Calculated MW 62kDa
Observed MW 62kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents