PTGR1 Polyclonal AntibodyPTGR1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PTGR1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4521-200ul 200ul
£332.50
A4521-100ul 100ul
£192.50
A4521-50ul 50ul
£113.75
A4521-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4521
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PTGR1; LTB4DH; PGR1; ZADH3; prostaglandin reductase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PTGR1 (NP_036344.2).
Reactivity Human, Mouse
Gene ID 22949
Calculated MW 32kDa/35kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents