POU4F3 Polyclonal AntibodyPOU4F3 Polyclonal Antibody
Move your mouse over image or click to enlarge

POU4F3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14049-200ul 200ul
£332.50
A14049-100ul 100ul
£192.50
A14049-50ul 50ul
£113.75
A14049-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14049
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names POU4F3; BRN3C; DFNA15; DFNA42; DFNA52; POU class 4 homeobox 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1).
Reactivity Human, Mouse, Rat
Gene ID 5459
Calculated MW 37kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents