POLR2F Polyclonal AntibodyPOLR2F Polyclonal Antibody
Move your mouse over image or click to enlarge

POLR2F Polyclonal Antibody

Cat# Size Price Qty Buy
A13171-200ul 200ul
£332.50
A13171-100ul 100ul
£192.50
A13171-50ul 50ul
£113.75
A13171-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13171
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names POLR2F; HRBP14.4; POLRF; RPABC14.4; RPABC2; RPB14.4; RPB6; RPC15; RNA polymerase II subunit F
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human POLR2F (NP_068809.1).
Reactivity Mouse
Gene ID 5435
Calculated MW 14kDa
Observed MW 17kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents