PODN Polyclonal AntibodyPODN Polyclonal Antibody
Move your mouse over image or click to enlarge

PODN Polyclonal Antibody

Cat# Size Price Qty Buy
A14309-200ul 200ul
£332.50
A14309-100ul 100ul
£192.50
A14309-50ul 50ul
£113.75
A14309-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14309
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PODN; PCAN; SLRR5A; podocan
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 67-210 of human PODN (NP_714914.2).
Reactivity Human, Mouse
Gene ID 127435
Calculated MW 57kDa/68kDa/72kDa/74kDa
Observed MW 69kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDCACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEKAFEHLTNLNYLYLANNKLTLAP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents