PMVK Polyclonal AntibodyPMVK Polyclonal Antibody
Move your mouse over image or click to enlarge

PMVK Polyclonal Antibody

Cat# Size Price Qty Buy
A13865-200ul 200ul
£332.50
A13865-100ul 100ul
£192.50
A13865-50ul 50ul
£113.75
A13865-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13865
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PMVK; HUMPMKI; PMK; PMKA; PMKASE; POROK1; phosphomevalonate kinase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human PMVK (NP_006547.1).
Reactivity Human, Mouse, Rat
Gene ID 10654
Calculated MW 21kDa
Observed MW 22kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents