PLS3 Polyclonal AntibodyPLS3 Polyclonal Antibody
Move your mouse over image or click to enlarge

PLS3 Polyclonal Antibody

Cat# Size Price Qty Buy
A3627-200ul 200ul
£332.50
A3627-100ul 100ul
£192.50
A3627-50ul 50ul
£113.75
A3627-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3627
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLS3; BMND18; T-plastin; plastin-3
Applications IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PLS3 (NP_005023.2).
Reactivity Human, Mouse, Rat
Gene ID 5358
Calculated MW 65kDa/69kDa/70kDa
Observed MW 71kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
Sensitivity WB,1:200 - 1:2000|IHC,1:50 - 1:100|IP,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents