PLEK Polyclonal AntibodyPLEK Polyclonal Antibody
Move your mouse over image or click to enlarge

PLEK Polyclonal Antibody

Cat# Size Price Qty Buy
A13338-200ul 200ul
£332.50
A13338-100ul 100ul
£192.50
A13338-50ul 50ul
£113.75
A13338-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13338
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLEK; P47; pleckstrin
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 189-350 of human PLEK (NP_002655.2).
Reactivity Human
Gene ID 5341
Calculated MW 40kDa
Observed MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents