PLA2G7 Polyclonal AntibodyPLA2G7 Polyclonal Antibody
Move your mouse over image or click to enlarge

PLA2G7 Polyclonal Antibody

Cat# Size Price Qty Buy
A13864-200ul 200ul
£332.50
A13864-100ul 100ul
£192.50
A13864-50ul 50ul
£113.75
A13864-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13864
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PLA2G7; LDL-PLA2; LP-PLA2; PAFAD; PAFAH; phospholipase A2 group VII
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 51-240 of human PLA2G7 (NP_005075.3).
Reactivity Human, Mouse, Rat
Gene ID 7941
Calculated MW 50kDa
Observed MW 50kDa/60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents