PHPT1 Polyclonal AntibodyPHPT1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PHPT1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13590-200ul 200ul
£332.50
A13590-100ul 100ul
£192.50
A13590-50ul 50ul
£113.75
A13590-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13590
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PHPT1; CGI-202; HEL-S-132P; HSPC141; PHP; PHP14; phosphohistidine phosphatase 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PHPT1 (NP_054891.2).
Reactivity Human
Gene ID 29085
Calculated MW 13kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents