PDHA2 Polyclonal AntibodyPDHA2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PDHA2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14038-200ul 200ul
£332.50
A14038-100ul 100ul
£192.50
A14038-50ul 50ul
£113.75
A14038-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14038
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PDHA2; PDHAL; pyruvate dehydrogenase (lipoamide) alpha 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 119-388 of human PDHA2 (NP_005381.1).
Reactivity Human, Mouse, Rat
Gene ID 5161
Calculated MW 42kDa
Observed MW 43kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents