PCDHGA1 Polyclonal AntibodyPCDHGA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PCDHGA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13193-200ul 200ul
£332.50
A13193-100ul 100ul
£192.50
A13193-50ul 50ul
£113.75
A13193-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13193
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PCDHGA1; PCDH-GAMMA-A1; protocadherin gamma-A1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human PCDHGA1 (NP_114382.1).
Reactivity Rat
Gene ID 56114
Calculated MW 90kDa/101kDa
Observed MW 90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PAFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKVLIKVLDVNDNAPEVTITSVTTAVPENF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents