P4HTM Polyclonal AntibodyP4HTM Polyclonal Antibody
Move your mouse over image or click to enlarge

P4HTM Polyclonal Antibody

Cat# Size Price Qty Buy
A13593-200ul 200ul
£332.50
A13593-100ul 100ul
£192.50
A13593-50ul 50ul
£113.75
A13593-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13593
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names P4HTM; EGLN4; HIFPH4; P4H-TM; PH-4; PH4; PHD4; transmembrane prolyl 4-hydroxylase
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 294-563 of human P4HTM (NP_808807.2).
Reactivity Human
Gene ID 54681
Calculated MW 47kDa/56kDa/63kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGTDSQPEWALDRAYRDARVEL
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents