OPN5 Polyclonal AntibodyOPN5 Polyclonal Antibody
Move your mouse over image or click to enlarge

OPN5 Polyclonal Antibody

Cat# Size Price Qty Buy
A15971-20ul 20ul
£77.00
A15971-50ul 50ul
£113.75
A15971-100ul 100ul
£192.50
A15971-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15971
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names OPN5; GPR136; GRP136; PGR12; TMEM13; opsin-5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human OPN5 (NP_859528.1).
Reactivity Human, Mouse, Rat
Gene ID 221391
Calculated MW 39kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents