OMG Polyclonal AntibodyOMG Polyclonal Antibody
Move your mouse over image or click to enlarge

OMG Polyclonal Antibody

Cat# Size Price Qty Buy
A14034-200ul 200ul
£332.50
A14034-100ul 100ul
£192.50
A14034-50ul 50ul
£113.75
A14034-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14034
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names OMG; OMGP; oligodendrocyte-myelin glycoprotein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-420 of human OMG (NP_002535.3).
Reactivity Human, Mouse
Gene ID 4974
Calculated MW 49kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence LTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents