OLIG3 Polyclonal AntibodyOLIG3 Polyclonal Antibody
Move your mouse over image or click to enlarge

OLIG3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13715-200ul 200ul
£332.50
A13715-100ul 100ul
£192.50
A13715-50ul 50ul
£113.75
A13715-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13715
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names OLIG3; Bhlhb7; bHLHe20; oligodendrocyte transcription factor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human OLIG3 (NP_786923.1).
Reactivity Mouse, Rat
Gene ID 167826
Calculated MW 29kDa
Observed MW 29kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents