NTRK3 Polyclonal AntibodyNTRK3 Polyclonal Antibody
Move your mouse over image or click to enlarge

NTRK3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14033-200ul 200ul
£332.50
A14033-100ul 100ul
£192.50
A14033-50ul 50ul
£113.75
A14033-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14033
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NTRK3; GP145-TrkC; TRKC; gp145(trkC); NT-3 growth factor receptor
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human NTRK3 (NP_001007157.1).
Reactivity Human, Mouse, Rat
Gene ID 4916
Calculated MW 68kDa/91kDa/92kDa/93kDa/94kDa
Observed MW 115kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents