NRSN2 Polyclonal AntibodyNRSN2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NRSN2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14425-200ul 200ul
£332.50
A14425-100ul 100ul
£192.50
A14425-50ul 50ul
£113.75
A14425-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14425
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NRSN2; C20orf98; dJ1103G7.6; neurensin-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human NRSN2 (NP_079234.1).
Reactivity Human, Mouse, Rat
Gene ID 80023
Calculated MW 21kDa
Observed MW 33kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents