NR3C2 Polyclonal AntibodyNR3C2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NR3C2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3308-200ul 200ul
£332.50
A3308-100ul 100ul
£192.50
A3308-50ul 50ul
£113.75
A3308-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3308
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NR3C2; MCR; MLR; MR; NR3C2VIT; mineralocorticoid receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human NR3C2 (NP_001159576.1).
Reactivity Human
Gene ID 4306
Calculated MW 75kDa/94kDa/107kDa
Observed MW 107kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents