NOX3 Polyclonal AntibodyNOX3 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOX3 Polyclonal Antibody

Cat# Size Price Qty Buy
A3677-200ul 200ul
£332.50
A3677-100ul 100ul
£192.50
A3677-50ul 50ul
£113.75
A3677-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3677
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOX3; GP91-3; MOX-2; NADPH oxidase 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 223-395 of human NOX3 (NP_056533.1).
Reactivity Human, Mouse, Rat
Gene ID 50508
Calculated MW 64kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30867238
Sequence GRIVRGQTQDSLSLHNITFCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVSHPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWTAALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTD
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents