NOL6 Polyclonal AntibodyNOL6 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOL6 Polyclonal Antibody

Cat# Size Price Qty Buy
A14420-200ul 200ul
£332.50
A14420-100ul 100ul
£192.50
A14420-50ul 50ul
£113.75
A14420-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14420
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOL6; NRAP; UTP22; bA311H10.1; nucleolar protein 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1032-1146 of human NOL6 (NP_075068.2).
Reactivity Human, Mouse, Rat
Gene ID 65083
Calculated MW 77kDa/112kDa/127kDa
Observed MW 127kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents