NOD2 Polyclonal AntibodyNOD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15992-20ul 20ul
£77.00
A15992-50ul 50ul
£113.75
A15992-100ul 100ul
£192.50
A15992-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15992
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOD2; ACUG; BLAU; BLAUS; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1; YAOS; nucleotide binding oligomerization domain containing 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 611-910 of human NOD2 (NP_071445.1).
Reactivity Human
Gene ID 64127
Calculated MW 22kDa/112kDa/115kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence AAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents