NGDN Polyclonal AntibodyNGDN Polyclonal Antibody
Move your mouse over image or click to enlarge

NGDN Polyclonal Antibody

Cat# Size Price Qty Buy
A14546-200ul 200ul
£332.50
A14546-100ul 100ul
£192.50
A14546-50ul 50ul
£113.75
A14546-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14546
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NGDN; C14orf120; CANu1; LCP5; NGD; lpd-2; neuroguidin
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 61-209 of human NGDN (NP_001036100.1).
Reactivity Human, Mouse, Rat
Gene ID 25983
Calculated MW 35kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents