NFATC2 Polyclonal AntibodyNFATC2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NFATC2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14189-200ul 200ul
£332.50
A14189-100ul 100ul
£192.50
A14189-50ul 50ul
£113.75
A14189-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14189
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NFATC2; NFAT1; NFATP; nuclear factor of activated T-cells 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human NFATC2 (NP_775114.1).
Reactivity Human, Mouse, Rat
Gene ID 4773
Calculated MW 76kDa/97kDa/98kDa/99kDa/100kDa
Observed MW 130kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents