NDUFA9 Polyclonal AntibodyNDUFA9 Polyclonal Antibody
Move your mouse over image or click to enlarge

NDUFA9 Polyclonal Antibody

Cat# Size Price Qty Buy
A3196-200ul 200ul
£332.50
A3196-100ul 100ul
£192.50
A3196-50ul 50ul
£113.75
A3196-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3196
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDUFA9; CC6; CI-39k; CI39k; NDUFS2L; SDR22E1; NADH:ubiquinone oxidoreductase subunit A9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human NDUFA9 (NP_004993.1).
Reactivity Human, Mouse, Rat
Gene ID 4704
Calculated MW 42kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 28583467
Sequence MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents