NCR3 Polyclonal AntibodyNCR3 Polyclonal Antibody
Move your mouse over image or click to enlarge

NCR3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14522-200ul 200ul
£332.50
A14522-100ul 100ul
£192.50
A14522-50ul 50ul
£113.75
A14522-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14522
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NCR3; 1C7; CD337; LY117; MALS; NKp30; natural cytotoxicity triggering receptor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCR3 (NP_667341.1).
Reactivity Human, Mouse, Rat
Gene ID 259197
Calculated MW 16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Observed MW 22kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents