NCAPG Polyclonal AntibodyNCAPG Polyclonal Antibody
Move your mouse over image or click to enlarge

NCAPG Polyclonal Antibody

Cat# Size Price Qty Buy
A13123-200ul 200ul
£332.50
A13123-100ul 100ul
£192.50
A13123-50ul 50ul
£113.75
A13123-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13123
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NCAPG; CAPG; CHCG; NY-MEL-3; YCG1; condensin complex subunit 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 610-700 of human NCAPG (NP_071741.2).
Reactivity Human
Gene ID 64151
Calculated MW 114kDa
Observed MW 114kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CCGLQNQDFARKHFVLLLQVLQIDDVTIKISALKAIFDQLMTFGIEPFKTKKIKTLHCEGTEINSDDEQESKEVEETATAKNVLKLLSDFL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents