MSMB Polyclonal AntibodyMSMB Polyclonal Antibody
Move your mouse over image or click to enlarge

MSMB Polyclonal Antibody

Cat# Size Price Qty Buy
A13625-200ul 200ul
£332.50
A13625-100ul 100ul
£192.50
A13625-50ul 50ul
£113.75
A13625-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13625
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MSMB; HPC13; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP-94; PSP57; PSP94; beta-microseminoprotein
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-114 of human MSMB (NP_002434.1).
Reactivity Human
Gene ID 4477
Calculated MW 8kDa/12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents