MRPS2 Polyclonal AntibodyMRPS2 Polyclonal Antibody
Move your mouse over image or click to enlarge

MRPS2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14279-200ul 200ul
£332.50
A14279-100ul 100ul
£192.50
A14279-50ul 50ul
£113.75
A14279-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14279
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MRPS2; CGI-91; MRP-S2; S2mt; mitochondrial ribosomal protein S2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-296 of human MRPS2 (NP_057118.1).
Reactivity Mouse
Gene ID 51116
Calculated MW 33kDa
Observed MW 33kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents