MPP5 Polyclonal AntibodyMPP5 Polyclonal Antibody
Move your mouse over image or click to enlarge

MPP5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13878-200ul 200ul
£332.50
A13878-100ul 100ul
£192.50
A13878-50ul 50ul
£113.75
A13878-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13878
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MPP5; PALS1; MAGUK p55 subfamily member 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 376-576 of human MPP5 (NP_071919.2).
Reactivity Mouse
Gene ID 64398
Calculated MW 73kDa/77kDa
Observed MW 77kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents