MOCS3 Polyclonal AntibodyMOCS3 Polyclonal Antibody
Move your mouse over image or click to enlarge

MOCS3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13417-200ul 200ul
£332.50
A13417-100ul 100ul
£192.50
A13417-50ul 50ul
£113.75
A13417-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13417
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MOCS3; UBA4; molybdenum cofactor synthesis 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 271-460 of human MOCS3 (NP_055299.1).
Reactivity Human, Mouse, Rat
Gene ID 27304
Calculated MW 49kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents