MOCOS Polyclonal AntibodyMOCOS Polyclonal Antibody
Move your mouse over image or click to enlarge

MOCOS Polyclonal Antibody

Cat# Size Price Qty Buy
A14343-200ul 200ul
£332.50
A14343-100ul 100ul
£192.50
A14343-50ul 50ul
£113.75
A14343-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14343
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MOCOS; HMCS; MCS; MOS; XAN2; molybdenum cofactor sulfurase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 649-888 of human MOCOS (NP_060417.2).
Reactivity Human
Gene ID 55034
Calculated MW 98kDa
Observed MW 98kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VIKAKGMEPIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKKHGKDQLPGTMATLSLVNEAQYLLINTSSILELHRQLNTSDENGKEELFSLKDLSLRFRANIIINGKRAFEEEKWDEISIGSLRFQVLGPCHRCQMICIDQQTGQRNQHVFQKLSESRETKVNFGMYLMHASLDLSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents