MLLT10 Polyclonal AntibodyMLLT10 Polyclonal Antibody
Move your mouse over image or click to enlarge

MLLT10 Polyclonal Antibody

Cat# Size Price Qty Buy
A14260-200ul 200ul
£332.50
A14260-100ul 100ul
£192.50
A14260-50ul 50ul
£113.75
A14260-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14260
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MLLT10; AF10; protein AF-10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-500 of human MLLT10 (NP_001182555.1).
Reactivity Human, Mouse
Gene ID 8028
Calculated MW 13kDa/20kDa/109kDa/113kDa
Observed MW 113kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EPSPALVPSLTVTTEKTYTSTSNNSISGSLKRLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents