MLF2 Polyclonal AntibodyMLF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

MLF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16076-20ul 20ul
£77.00
A16076-50ul 50ul
£113.75
A16076-100ul 100ul
£192.50
A16076-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16076
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MLF2; NTN4; myeloid leukemia factor 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1).
Reactivity Human, Mouse, Rat
Gene ID 8079
Calculated MW 28kDa
Observed MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVS
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents