MIOX Polyclonal AntibodyMIOX Polyclonal Antibody
Move your mouse over image or click to enlarge

MIOX Polyclonal Antibody

Cat# Size Price Qty Buy
A14409-200ul 200ul
£332.50
A14409-100ul 100ul
£192.50
A14409-50ul 50ul
£113.75
A14409-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14409
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MIOX; ALDRL6; inositol oxygenase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-285 of human MIOX (NP_060054.4).
Reactivity Mouse, Rat
Gene ID 55586
Calculated MW 24kDa/33kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents