MGAT4C Polyclonal AntibodyMGAT4C Polyclonal Antibody
Move your mouse over image or click to enlarge

MGAT4C Polyclonal Antibody

Cat# Size Price Qty Buy
A14326-200ul 200ul
£332.50
A14326-100ul 100ul
£192.50
A14326-50ul 50ul
£113.75
A14326-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14326
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MGAT4C; GNTIVH; HGNT-IV-H; MGAT4 family member C
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 299-478 of human MGAT4C (NP_037376.2).
Reactivity Human
Gene ID 25834
Calculated MW 56kDa/59kDa
Observed MW 56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KNVIRFKPSLFQHMGYYSSYKGTENKLKDDDFEEESFDIPDNPPASLYTNMNVFENYEASKAYSSVDEYFWGKPPSTGDVFVIVFENPIIIKKIKVNTGTEDRQNDILHHGALDVGENVMPSKQRRQCSTYLRLGEFKNGNFEMSGVNQKIPFDIHCMRIYVTKTQKEWLIIRSISIWTS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents