MEF2B Polyclonal AntibodyMEF2B Polyclonal Antibody
Move your mouse over image or click to enlarge

MEF2B Polyclonal Antibody

Cat# Size Price Qty Buy
A15987-20ul 20ul
£77.00
A15987-50ul 50ul
£113.75
A15987-100ul 100ul
£192.50
A15987-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15987
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MEF2B; RSRFR2; myocyte enhancer factor 2B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2B (NP_005910.1).
Reactivity Human
Gene ID 100271849
Calculated MW 38kDa/39kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPEL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents