MED7 Polyclonal AntibodyMED7 Polyclonal Antibody
Move your mouse over image or click to enlarge

MED7 Polyclonal Antibody

Cat# Size Price Qty Buy
A16088-20ul 20ul
£77.00
A16088-50ul 50ul
£113.75
A16088-100ul 100ul
£192.50
A16088-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16088
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MED7; ARC34; CRSP33; CRSP9; mediator complex subunit 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-233 of human MED7 (NP_004261.1).
Reactivity Human, Mouse, Rat
Gene ID 9443
Calculated MW 27kDa
Observed MW 27kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents