MED4 Polyclonal AntibodyMED4 Polyclonal Antibody
Move your mouse over image or click to enlarge

MED4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14123-200ul 200ul
£332.50
A14123-100ul 100ul
£192.50
A14123-50ul 50ul
£113.75
A14123-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14123
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MED4; ARC36; DRIP36; HSPC126; TRAP36; VDRIP; mediator complex subunit 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human MED4 (NP_054885.1).
Reactivity Human, Rat
Gene ID 29079
Calculated MW 24kDa/29kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents