MECP2 Polyclonal AntibodyMECP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

MECP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13328-200ul 200ul
£332.50
A13328-100ul 100ul
£192.50
A13328-50ul 50ul
£113.75
A13328-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13328
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MECP2; AUTSX3; MRX16; MRX79; MRXS13; MRXSL; PPMX; RS; RTS; RTT; methyl-CpG-binding protein 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MECP2 (NP_004983.1).
Reactivity Human, Mouse
Gene ID 4204
Calculated MW 52kDa/53kDa
Observed MW 52kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTL
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents