MCMBP Polyclonal AntibodyMCMBP Polyclonal Antibody
Move your mouse over image or click to enlarge

MCMBP Polyclonal Antibody

Cat# Size Price Qty Buy
A14149-200ul 200ul
£332.50
A14149-100ul 100ul
£192.50
A14149-50ul 50ul
£113.75
A14149-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14149
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MCMBP; C10orf119; MCM-BP; minichromosome maintenance complex binding protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human MCMBP (NP_079110.1).
Reactivity Human, Mouse, Rat
Gene ID 79892
Calculated MW 52kDa/72kDa
Observed MW 72kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPCGEDWLSHPLGIVQGFFAQNGVNPDWEKKVIEYFKEKLKENNAPKWVPSLNEVPLHYLKPNSFVKFRCMIQDMFDPEFYMGVYETVNQNTKAHVLHFGKYRDVAECGPQQELDLNSPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQQLNSLNLSSPFDLNFPLPGEKGPACL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents