MC1R Polyclonal AntibodyMC1R Polyclonal Antibody
Move your mouse over image or click to enlarge

MC1R Polyclonal Antibody

Cat# Size Price Qty Buy
A13512-200ul 200ul
£332.50
A13512-100ul 100ul
£192.50
A13512-50ul 50ul
£113.75
A13512-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13512
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MC1R; CMM5; MSH-R; SHEP2; melanocortin 1 receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human MC1R (NP_002377.4).
Reactivity Mouse, Rat
Gene ID 4157
Calculated MW 34kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVVATIAKNRNLHSPMYCFICCL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents