MAP3K1 Polyclonal AntibodyMAP3K1 Polyclonal Antibody
Move your mouse over image or click to enlarge

MAP3K1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16057-20ul 20ul
£77.00
A16057-50ul 50ul
£113.75
A16057-100ul 100ul
£192.50
A16057-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16057
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAP3K1; MAPKKK1; MEKK; MEKK 1; MEKK1; SRXY6; mitogen-activated protein kinase kinase kinase 1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human MAP3K1 (NP_005912.1).
Reactivity Human, Mouse, Rat
Gene ID 4214
Calculated MW 164kDa
Observed MW 164kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents