LRRC7 Polyclonal AntibodyLRRC7 Polyclonal Antibody
Move your mouse over image or click to enlarge

LRRC7 Polyclonal Antibody

Cat# Size Price Qty Buy
A13114-200ul 200ul
£332.50
A13114-100ul 100ul
£192.50
A13114-50ul 50ul
£113.75
A13114-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13114
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LRRC7; DENSIN; leucine rich repeat containing 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 730-890 of human LRRC7 (NP_065845.1).
Reactivity Mouse, Rat
Gene ID 57554
Calculated MW 20kDa/167kDa/172kDa
Observed MW 172kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FPQPLDSKPLLSQREAVPPGNIPQRPDRLPMSDTFTDNWTDGSHYDNTGFVAEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSNPWQNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents