LASP1 Polyclonal AntibodyLASP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

LASP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3941-200ul 200ul
£332.50
A3941-100ul 100ul
£192.50
A3941-50ul 50ul
£113.75
A3941-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3941
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names LASP1; Lasp-1; MLN50; LIM and SH3 protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1).
Reactivity Human, Mouse
Gene ID 3927
Calculated MW 23kDa/29kDa/36kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK
Sensitivity WB,1:1000 - 1:3000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents